« Back
Home /
Recombinant Escherichia coli Penicillin-binding protein 1A(mrcA),partial

Recombinant Escherichia coli Penicillin-binding protein 1A(mrcA),partial

Item no.	CSB-EP365805ENV-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Food Safety Antibiotics Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MLDEGYITQQQFDQTRTEAINANYHAPEIAFSAPY LSEMVRQEMYNRYGESAYEDGYRIYTTITRKVQQA AQQAVRNNVLDYDMRHGYRGPANVLWKVGESAWDN NKITDTLKALPTYGPLLPAAVTSANPQQATAMLAD GSTVALSMEGVRWARPYRSDTQQGPTPRKVTDVLQ TGQQIWVRQVGDAWWLAQVPEVNSALVSINPQNGA VMALVGGFDFNQSKFNRATQALRQVGSNIKPFLYT AAM
Protein Family	Glycosyltransferase 51 family; Transpeptidase family
Citations	Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) .
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	PBP-1a,PBP1a,Including the following 2 domains:,Penicillin-insensitive transglycosylase,Peptidoglycan TGase,Penicillin-sensitive transpeptidase,DD-transpeptidase
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	49.5 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Microbiology
Relevance	Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
Expression Region	229-529aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
Subcellular Location	Cell inner membrane, Single-pass type II membrane protein
Gene Names	mrcA
Sequence Info	Partial
Organism	Escherichia coli (strain K12)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP365805ENV-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 1/15/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer