« Back
Home /
Recombinant Escherichia coli Penicillin-binding protein 1A(mrcA),partial

Recombinant Escherichia coli Penicillin-binding protein 1A(mrcA),partial

Manufacturer	Cusabio
Category	Food Safety Antibiotics Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Host	E.coli
Item no.	CSB-EP365805ENV-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Microbiology
Uniprot ID	P02918
Gene Names	mrcA
Organism	Escherichia coli (strain K12)
AA Sequence	MLDEGYITQQQFDQTRTEAINANYHAPEIAFSAPY LSEMVRQEMYNRYGESAYEDGYRIYTTITRKVQQA AQQAVRNNVLDYDMRHGYRGPANVLWKVGESAWDN NKITDTLKALPTYGPLLPAAVTSANPQQATAMLAD GSTVALSMEGVRWARPYRSDTQQGPTPRKVTDVLQ TGQQIWVRQVGDAWWLAQVPEVNSALVSINPQNGA VMALVGGFDFNQSKFNRATQALRQVGSNIKPFLYT AAMDKGLTLASMLNDVPISRWDASAGSDWQPKNSP PQYAGPIRLRQGLGQSKNVVM
Expression Region	229-529aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	49.5 kDa
Alternative Name(s)	Short name: PBP-1a Short name: PBP1a Including the following 2 domains: Penicillin-insensitive transglycosylase Alternative name(s): Peptidoglycan TGase Penicillin-sensitive transpeptidase Alternative name(s): DD-transpeptidase
Relevance	Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
Reference	"Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110."Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) .
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
Subcellular Location	Cell inner membrane, Single-pass type II membrane protein
Protein Families	Glycosyltransferase 51 family; Transpeptidase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time