Comparison

Recombinant Epstein-Barr virus Replication and transcription activator(BRLF1),partial

Item no. CSB-EP662061EFC-1
Manufacturer Cusabio
Amount 1 mg
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Human (Homo sapiens)
Host E.coli
Conjugate/Tag Myc, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence PRLRAPKSRRTSRPNRGQTPCPSNAEEPEQPWIAA VHQESDERPIFPHPSKPTFLPPVKRKKGLRDSREG MFLPKPEAGSAISDVFEGREVCQPKRIRPFHPPGS PWANRPLPASLAPTPTGPVHEPVGSLTPAPVPKPL DPAPAVTPEASHLLEDPDEETSQAVKALREMADTV IPQKEEAAICGQMDLNHPPPRGHLDELTTTLESMT EDLNLDSPLTPELNEILDTFLNDECLLHAMHISTG LSI
Protein Family Herpesviridae Rta family
Citations Evolutionarily conserved herpesviral protein interaction networks.
Fossum E., Friedel C.C., Rajagopala S.V., Titz B., Baiker A., Schmidt T., Kraus T., Stellberger T., Rutenberg C., Suthram S., Bandyopadhyay S., Rose D., von Brunn A., Uhlmann M., Zeretzke C., Dong Y.A., Boulet H., Koegl M.
Haas J.
PLoS Pathog. 5:e1000570-e1000570(2009)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Immediate-early protein Rta
Available
Manufacturer - Targets
BRLF1
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
34.9 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
Immediate-early transcription factor that controls the initiation of viral lytic gene expression and lytic reactivation from latency. Triggers lytic replication, and initiates a cellular senescence program in epithelial cells. Upregulates human DCR3/TNFRSF6B by directly binding to its receptor
Biologically Active
Not Test
Expression Region
352-605aa
Protein Length
Partial
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Immediate-early transcription factor that controls the initiation of viral lytic gene expression and lytic reactivation from latency. Triggers lytic replication, and initiates a cellular senescence program in epithelial cells. Upregulates human DCR3/TNFRSF6B by directly binding to its receptor (By similarity).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close