« Back
Home /
Recombinant Mouse Allergin-1(Milr1),partial

Recombinant Mouse Allergin-1(Milr1),partial

Item no.	CSB-EP662302MO-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Mouse (Murine, Mus musculus)
Host	E.coli
Conjugate/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQN VSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAV DFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTM AKDESCPSCRLS
Citations	An immunoglobulin-like receptor, Allergin-1, inhibits immunoglobulin E-mediated immediate hypersensitivity reactions. Hitomi K., Tahara-Hanaoka S., Someya S., Fujiki A., Tada H., Sugiyama T., Shibayama S., Shibuya K., Shibuya A. Nat. Immunol. 11:601-607(2010)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Allergy inhibitory receptor 1; Mast cell antigen 32; Short name:; MCA-32; Short name:; Mast cell Ag-32; Mast cell immunoglobulin-like receptor 1; Gm885, Mca32
Available
Manufacturer - Targets	Milr1
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	20.1 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance	Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction.
Biologically Active	Not Test
Expression Region	34-150aa
Protein Length	Extracellular Domain
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction.
Subcellular Location	Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted
Tissue Specificity	Expressed in myeloid cells (dendritic cells, macrophages and neutrophils but not in T-cells, B-cells or natural killer cells) and mast cells (at protein level).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP662302MO-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 6/19/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail