Item no. |
CSB-EP662302MO-10 |
Manufacturer |
Cusabio
|
Amount |
10 ug |
Quantity options |
1 mg
10 ug
100 ug
20 ug
200 ug
50 ug
500 ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Conjugate/Tag |
Myc, HIS |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Sequence |
ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQN VSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAV DFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTM AKDESCPSCRLS |
Citations |
"An immunoglobulin-like receptor, Allergin-1, inhibits immunoglobulin E-mediated immediate hypersensitivity reactions." Hitomi K., Tahara-Hanaoka S., Someya S., Fujiki A., Tada H., Sugiyama T., Shibayama S., Shibuya K., Shibuya A. Nat. Immunol. 11:601-607(2010) |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Allergy inhibitory receptor 1; Mast cell antigen 32; Short name:; MCA-32; Short name:; Mast cell Ag-32; Mast cell immunoglobulin-like receptor 1; Gm885, Mca32 |
Available |
|
Manufacturer - Targets |
Milr1 |
Manufacturer - Conjugate / Tag |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Storage Conditions |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Molecular Weight |
20.1 kDa |
Relevance |
Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction. |
Expression Region |
34-150aa |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction. |
Subcellular Location |
Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted |
Tissue Specificity |
Expressed in myeloid cells (dendritic cells, macrophages and neutrophils but not in T-cells, B-cells or natural killer cells) and mast cells (at protein level). |
Biologically active |
Not Test |
Protein length |
Extracellular Domain |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.