Comparison

Recombinant Human Cyclic AMP-responsive element-binding protein 3-like protein 2(CREB3L2)

Item no. CSB-EP754617HU-200
Manufacturer Cusabio
Amount 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTH FSELLDEFSQNVLGQLLNDPFLSEKSVSMEVEPSP TSPAPLIQAEHSYSLCEEPRAQSPFTHITSDSFND DEVESEKWYLSTDFPSTSIKTEPVTDEPPPGLVPS VTLTITAISTPLEKEEPPLEMNTGVDSSCQTIIPK IKLEPHEVDQFLNFSPKEGLSALPVSLWVMDMVSG STEREYGERAGMSLYHRCCSWLYEIALFLKNKNFA SK
Protein Family BZIP family, ATF subfamily
Citations "Fusion of the FUS and BBF2H7 genes in low grade fibromyxoid sarcoma."
Storlazzi C.T., Mertens F., Nascimento A., Isaksson M., Wejde J., Brosjoe O., Mandahl N., Panagopoulos I.
Hum. Mol. Genet. 12:2349-2358(2003)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias BBF2 human homolog on chromosome 7
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
54.6 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Epigenetics and Nuclear Signaling
Relevance
Transcription factor involved in unfolded protein response (UPR). In the absence of endoplasmic reticulum (ER) stress, inserted into ER membranes, with N-terminal DNA-binding and transcription activation domains oriented toward the cytosolic face of the membrane. In response to ER stress, transported to the Golgi, where it is cleaved in a site-specific manner by resident proteases S1P/MBTPS1 and S2P/MBTPS2. The released N-terminal cytosolic domain is translocated to the nucleus to effect transcription of specific target genes. Plays a critical role in chondrogenesis by activating the transcription of SEC23A, which promotes the transport and secretion of cartilage matrix proteins, and possibly that of ER biogenesis-related genes. In a neuroblastoma cell line, protects cells from ER stress-induced death. In vitro activates transcription of target genes via direct binding to the CRE site.
Expression Region
1-247aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Transcription factor involved in unfolded protein response (UPR). In the absence of endoplasmic reticulum (ER) stress, inserted into ER membranes, with N-terminal DNA-binding and transcription activation domains oriented toward the cytosolic face of the membrane. In response to ER stress, transported to the Golgi, where it is cleaved in a site-specific manner by resident proteases S1P/MBTPS1 and S2P/MBTPS2. The released N-terminal cytosolic domain is translocated to the nucleus to effect transcription of specific target genes. Plays a critical role in chondrogenesis by activating the transcription of SEC23A, which promotes the transport and secretion of cartilage matrix proteins, and possibly that of ER biogenesis-related genes (By similarity). In a neuroblastoma cell line, protects cells from ER stress-induced death
Subcellular Location
Endoplasmic reticulum membrane, Single-pass type II membrane protein, Note=ER membrane resident protein, Upon ER stress, translocated to the Golgi apparatus where it is cleaved, The cytosolic N-terminal fragment (processed cyclic AMP-responsive element-binding protein 3-like protein 1) is transported into the nucleus, SUBCELLULAR LOCATION: Processed cyclic AMP-responsive element-binding protein 3-like protein 2: Nucleus
Tissue Specificity
Widely expressed with highest levels in placenta, lung, spleen and intestine, and lowest levels in heart, brain, skeletal muscle, thymus, colon and leukocytes. In fetal tissues, the weakest expression is detected in brain and heart.
Involvement in disease
A chromosomal aberration involving CREB3L2 is found in low grade fibromyxoid sarcoma (LGFMS). Translocation t(7; 16)(q33; p11) with FUS.
Pathway
cAMPsignalingpathway
Gene Names
CREB3L2
Sequence Info
Full Length of BC063666
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close