Comparison

Recombinant Human metapneumovirus Matrix protein(M)

Item no. CSB-EP761526HDAM-200
Manufacturer Cusabio
Amount 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag Myc, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MESYLVDTYQGIPYTAAVQVDLVEKDLLPASLTIW FPLFQANTPPAVLLDQLKTLTITTLYAASQSGPIL KVNASAQGAAMSVLPKKFEVNATVALDEYSKLEFD KLTVCEVKTVYLTTMKPYGMVSKFVSSAKPVGKKT HDLIALCDFMDLEKNTPVTIPAFIKSVSIKESESA TVEAAISSEADQALTQAKIAPYAGLIMIMTMNNPK GIFKKLGAGTQVIVELGAYVQAESISKICKTWSHQ GTR
Protein Family Paramyxoviruses M protein family
Citations "Chimeric recombinant human metapneumoviruses with the nucleoprotein or phosphoprotein open reading frame replaced by that of avian metapneumovirus exhibit improved growth in vitro and attenuation in vivo."
Pham Q.N., Biacchesi S., Skiadopoulos M.H., Murphy B.R., Collins P.L., Buchholz U.J.
J. Virol. 79:15114-15122(2005)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Manufacturer - Targets
M
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
35.1 kDa
General Research Areas
Signal Transduction
Relevance
Has a crucial role in virus assembly and budding. The matrix interacts with the RNP complex and this association serves two functions: facilitate virion assembly and inhibit the viral transcriptase activity. Early in infection, M is localized to the nucleus and may inhibit host cell transcription. Later on, M can associate with lipid rafts supposely by interacting with the cytoskeleton and with the cytoplasmic tail of glycoprotein G. The binding of M to host membrane is stabilized by the surface expression of the viral glycoproteins. These interactions may allow virus formation by mediating association of the nucleocapsid with the nascent envelope.
Expression Region
1-254aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Has a crucial role in virus assembly and budding. The matrix interacts with the RNP complex and this association serves two functions
Subcellular Location
Virion, Host cytoplasm, Host nucleus, Host cell membrane, Peripheral membrane protein, Cytoplasmic side
Biologically active
Not Test
Protein length
Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Delivery expected until 8/28/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close