« Back
Home /
Recombinant Human Cytoplasmic dynein 2 light intermediate chain 1(DYNC2LI1)

Recombinant Human Cytoplasmic dynein 2 light intermediate chain 1(DYNC2LI1)

Item no.	CSB-EP844722HU-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	Myc, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MPSETLWEIAKAEVEKRGINGSEGDGAEIAEKFVF FIGSKNGGKTTIILRCLDRDEPPKPTLALEYTYGR RAKGHNTPKDIAHFWELGGGTSLLDLISIPITGDT LRTFSLVLVLDLSKPNDLWPTMENLLQATKSHVDK VIMKLGKTNAKAVSEMRQKIWNNMPKDHPQDHELI DPFPVPLVIIGSKYDVFQDFESEKRKVICKTLRFV AHYYGASLMFTSKSEALLLKIRGVINQLAFGIDKS KSI
Protein Family	Dynein light intermediate chain family
Citations	"Identification of a novel light intermediate chain (D2LIC) for mammalian cytoplasmic dynein 2."Grissom P.M., Vaisberg E.A., McIntosh J.R.Mol. Biol. Cell 13:817-829(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	44.8 kDa
General Research Areas	Signal Transduction
Relevance	May function as a motor for intraflagellar retrograde transport. Functions in cilia biogenesis (By similarity).
Expression Region	1-352aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required for correct intraflagellar transport (IFT), the bi-directional movement of particles required for the assembly, maintenance and functioning of primary cilia. Involved in the regulation of ciliary length.
Subcellular Location	Cytoplasm, Cell projection, cilium, Cytoplasm, cytoskeleton, cilium basal body, Cytoplasm, cytoskeleton, cilium axoneme, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
Tissue Specificity	Expressed in bone, brain, kidney, and cartilage (PubMed:26077881, PubMed:26130459). Lower expression in heart, liver, lung, placenta and thymus (PubMed:26077881).
Involvement in disease	Short-rib thoracic dysplasia 15 with polydactyly (SRTD15)
Gene Names	DYNC2LI1
Sequence Info	Full Length of Isoform 2
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP844722HU-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer