Comparison

Recombinant Saccharomyces cerevisiae Diphosphoinositol polyphosphate phosphohydrolase DDP1(DDP1)

Item no. CSB-EP860334SVG-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GKTADNHGPVRSETAREGRENQVYSPVTGARLVAG CICLTPDKKQVLMITSSAHKKRWIVPKGGVEKDEP NYETTAQRETWEEAGCIGKIVANLGTVEDMRPPKD WNKDIKQFENSRKDSEVAKHPPRTEFHFYELEIEN LLDKFPECHKRHRKLYSYTEAKQNLIDAKRPELLE ALNRSAIIKDDK
Protein Family Nudix hydrolase family, DIPP subfamily
Citations "The diadenosine hexaphosphate hydrolases from Schizosaccharomyces pombe and Saccharomyces cerevisiae are homologues of the human diphosphoinositol polyphosphate phosphohydrolase. Overlapping substrate specificities in a MutT-type protein."Safrany S.T., Ingram S.W., Cartwright J.L., Falck J.R., McLennan A.G., Barnes L.D., Shears S.B.J. Biol. Chem. 274:21735-21740(1999)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase; Short name:; Ap6A hydrolase; Diadenosine and diphosphoinositol polyphosphate phosphohydrolase 1; Diadenosine hexaphosphate hydrolase (AMP-forming)
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
37.4 kDa
Relevance
May eliminate potentially toxic dinucleoside polyphosphates during sporulation. Most active against diadenosine 5', 5'''-P1, P6-hexaphosphate (Ap6A). Can also hydrolyze diadenosine 5', 5'''-P1, P5-pentaphosphate (Ap5A), adenosine 5'-pentaphosphate, and adenosine 5'-tetraphosphate are also substrates, but not diadenosine 5', 5'''-P1, P4-tetraphosphate (Ap4A) or other dinucleotides, mononucleotides, nucleotide sugars, or nucleotide alcohols. Also cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate)
Expression Region
2-188aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
May eliminate potentially toxic dinucleoside polyphosphates during sporulation. Most active against diadenosine 5', 5'''-P1, P6-hexaphosphate (Ap6A). Can also hydrolyze diadenosine 5', 5'''-P1, P5-pentaphosphate (Ap5A), adenosine 5'-pentaphosphate, and adenosine 5'-tetraphosphate are also substrates, but not diadenosine 5', 5'''-P1, P4-tetraphosphate (Ap4A) or other dinucleotides, mononucleotides, nucleotide sugars, or nucleotide alcohols. Also cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate).
Subcellular Location
Cytoplasm, Nucleus
Gene Names
DDP1
Sequence Info
Full Length of Mature Protein
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Delivery expected until 8/28/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close