« Back
Home /
Recombinant Saccharomyces cerevisiae Diphosphoinositol polyphosphate phosphohydrolase DDP1(DDP1)

Recombinant Saccharomyces cerevisiae Diphosphoinositol polyphosphate phosphohydrolase DDP1(DDP1)

Item no.	CSB-EP860334SVG-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	GKTADNHGPVRSETAREGRENQVYSPVTGARLVAG CICLTPDKKQVLMITSSAHKKRWIVPKGGVEKDEP NYETTAQRETWEEAGCIGKIVANLGTVEDMRPPKD WNKDIKQFENSRKDSEVAKHPPRTEFHFYELEIEN LLDKFPECHKRHRKLYSYTEAKQNLIDAKRPELLE ALNRSAIIKDDK
Protein Family	Nudix hydrolase family, DIPP subfamily
Citations	"The diadenosine hexaphosphate hydrolases from Schizosaccharomyces pombe and Saccharomyces cerevisiae are homologues of the human diphosphoinositol polyphosphate phosphohydrolase. Overlapping substrate specificities in a MutT-type protein."Safrany S.T., Ingram S.W., Cartwright J.L., Falck J.R., McLennan A.G., Barnes L.D., Shears S.B.J. Biol. Chem. 274:21735-21740(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase; Short name:; Ap6A hydrolase; Diadenosine and diphosphoinositol polyphosphate phosphohydrolase 1; Diadenosine hexaphosphate hydrolase (AMP-forming)
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	37.4 kDa
Relevance	May eliminate potentially toxic dinucleoside polyphosphates during sporulation. Most active against diadenosine 5', 5'''-P1, P6-hexaphosphate (Ap6A). Can also hydrolyze diadenosine 5', 5'''-P1, P5-pentaphosphate (Ap5A), adenosine 5'-pentaphosphate, and adenosine 5'-tetraphosphate are also substrates, but not diadenosine 5', 5'''-P1, P4-tetraphosphate (Ap4A) or other dinucleotides, mononucleotides, nucleotide sugars, or nucleotide alcohols. Also cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate)
Expression Region	2-188aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May eliminate potentially toxic dinucleoside polyphosphates during sporulation. Most active against diadenosine 5', 5'''-P1, P6-hexaphosphate (Ap6A). Can also hydrolyze diadenosine 5', 5'''-P1, P5-pentaphosphate (Ap5A), adenosine 5'-pentaphosphate, and adenosine 5'-tetraphosphate are also substrates, but not diadenosine 5', 5'''-P1, P4-tetraphosphate (Ap4A) or other dinucleotides, mononucleotides, nucleotide sugars, or nucleotide alcohols. Also cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate).
Subcellular Location	Cytoplasm, Nucleus
Gene Names	DDP1
Sequence Info	Full Length of Mature Protein
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP860334SVG-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer