« Back
Home /
Recombinant Human Dynein light chain roadblock-type 1(DYNLRB1),partial

Recombinant Human Dynein light chain roadblock-type 1(DYNLRB1),partial

Item no.	CSB-EP865093HU-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Hepatic Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNP TTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIR SKKNEIMVAPDKDYFLIVIQNPTE
Protein Family	GAMAD family
Citations	Identification of two novel human dynein light chain genes, DNLC2A and DNLC2B, and their expression changes in hepatocellular carcinoma tissues from 68 Chinese patients.Jiang J., Yu L., Huang X., Chen X., Li D., Zhang Y., Tang L., Zhao S.Gene 281:103-113(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Bithoraxoid-like protein ;BLPDynein light chain 2A, Cytoplasmic domainDynein-associated protein Km23Roadblock domain-containing protein 1
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	26.7 kDa
General Research Areas	Cancer
Relevance	Acts as one of several non-catalytic accessory components of the Cytoplasmic domain dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic domain dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.
Expression Region	3-96aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.
Subcellular Location	Cytoplasm, cytoskeleton
Tissue Specificity	High expression in heart, liver, brain and pancreas; moderate in placenta, skeletal muscle and kidney; low in lung, prostate, testis, small intestine and colon. Isoform 1 expression is up-regulated in 64% hepatocellular carcinoma (HCC) patients.
Gene Names	DYNLRB1
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP865093HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer