« Back
Home /
Recombinant Mouse Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1(Lingo1),partial

Recombinant Mouse Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1(Lingo1),partial

Item no.	CSB-EP880476MO-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Neuroscience Molecular Targets for Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	PPRCECSAQDRAVLCHRKRFVAVPEGIPTETRLLD LGKNRIKTLNQDEFASFPHLEELELNENIVSAVEP GAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTK LDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYI SHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGL IVLRLRHLNINAIRDYSFKRLYRLKVLEISHWPYL DTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLV YLR
Citations	Nogo-a regulates neural precursor migration in the embryonic mouse cortex.Mathis C., Schroeter A., Thallmair M., Schwab M.E.Cereb. Cortex 20:2380-2390(2010)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Leucine-rich repeat neuronal protein 1Leucine-rich repeat neuronal protein 6A
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	62.9 kDa
Relevance	Functional component of the Nogo receptor signaling complex (RTN4R/NGFR) in RhoA activation responsible for some inhibition of axonal regeneration by myelin-associated factors. Is also an important negative regulator of oligodentrocyte differentiation and axonal myelination . Acts in conjunction with RTN4 and RTN4R in regulating neuronal precursor cell motility during cortical development.1 Publication
Expression Region	37-555aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Functional component of the Nogo receptor signaling complex (RTN4R/NGFR) in RhoA activation responsible for some inhibition of axonal regeneration by myelin-associated factors. Is also an important negative regulator of oligodentrocyte differentiation and axonal myelination (By similarity). Acts in conjunction with RTN4 and RTN4R in regulating neuronal precursor cell motility during cortical development.
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Tissue Specificity	Highly specific expression in the central nervous system. Predominant expression in neocortex, amygdala, hippocampus, thalamus and entorhinal cortex, with lower levels in cerebellum and basal nuclei.
Gene Names	Lingo1
Sequence Info	Extracellular Domain
Organism	Mus musculus (Mouse)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP880476MO-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer