Comparison

Recombinant Mouse Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1(Lingo1),partial

Item no. CSB-EP880476MO-500
Manufacturer Cusabio
Amount 500 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PPRCECSAQDRAVLCHRKRFVAVPEGIPTETRLLD LGKNRIKTLNQDEFASFPHLEELELNENIVSAVEP GAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTK LDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYI SHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGL IVLRLRHLNINAIRDYSFKRLYRLKVLEISHWPYL DTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLV YLR
Citations Nogo-a regulates neural precursor migration in the embryonic mouse cortex.Mathis C., Schroeter A., Thallmair M., Schwab M.E.Cereb. Cortex 20:2380-2390(2010)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Leucine-rich repeat neuronal protein 1Leucine-rich repeat neuronal protein 6A
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
62.9 kDa
Relevance
Functional component of the Nogo receptor signaling complex (RTN4R/NGFR) in RhoA activation responsible for some inhibition of axonal regeneration by myelin-associated factors. Is also an important negative regulator of oligodentrocyte differentiation and axonal myelination . Acts in conjunction with RTN4 and RTN4R in regulating neuronal precursor cell motility during cortical development.1 Publication
Expression Region
37-555aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Functional component of the Nogo receptor signaling complex (RTN4R/NGFR) in RhoA activation responsible for some inhibition of axonal regeneration by myelin-associated factors. Is also an important negative regulator of oligodentrocyte differentiation and axonal myelination (By similarity). Acts in conjunction with RTN4 and RTN4R in regulating neuronal precursor cell motility during cortical development.
Subcellular Location
Cell membrane, Single-pass type I membrane protein
Tissue Specificity
Highly specific expression in the central nervous system. Predominant expression in neocortex, amygdala, hippocampus, thalamus and entorhinal cortex, with lower levels in cerebellum and basal nuclei.
Gene Names
Lingo1
Sequence Info
Extracellular Domain
Organism
Mus musculus (Mouse)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close