« Back
Home /
Recombinant Human Transcription factor 7-like 2(TCF7L2),partial

Recombinant Human Transcription factor 7-like 2(TCF7L2),partial

Item no.	CSB-EP889079HU-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENS SAERDLADVKSSLVNESETNQNSSSDSEAERRPPP RSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPF IMIPDLTSPYLPNGSLSPTARTLHFQSGSTHYSAY KTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDA RSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEH FTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPL SPG
Protein Family	TCF/LEF family
Citations	"Identification of c-MYC as a target of the APC pathway."He T.-C., Sparks A.B., Rago C., Hermeking H., Zawel L., da Costa L.T., Morin P.J., Vogelstein B., Kinzler K.W.Science 281:1509-1512(1998)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HMG box transcription factor 4; T-cell-specific transcription factor 4; Short name:; T-cell factor 4; Short name:; TCF-4; Short name:; hTCF-4
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	54.9 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promoters with several copies of the Tcf motif 5'-CCTTTGATC-3' in the presence of CTNNB1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7L2/TCF4 and CTNNB1. Expression of dominant-negative mutants results in cell-cycle arrest in G1. Necessary for the maintenance of the epithelial stem-cell compartment of the small intestine.
Expression Region	1-456aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promoters with several copies of the Tcf motif 5'-CCTTTGATC-3' in the presence of CTNNB1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7L2/TCF4 and CTNNB1. Expression of dominant-negative mutants results in cell-cycle arrest in G1. Necessary for the maintenance of the epithelial stem-cell compartment of the small intestine.
Subcellular Location	Nucleus, PML body
Tissue Specificity	Detected in epithelium from small intestine, with the highest expression at the top of the crypts and a gradient of expression from crypt to villus. Detected in colon epithelium and colon cancer, and in epithelium from mammary gland and carcinomas derived therefrom.
Involvement in disease	Diabetes mellitus, non-insulin-dependent (NIDDM)
Paythway	Hipposignalingpathway
Gene Names	TCF7L2
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP889079HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 10/16/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer