Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
50ug |
Host |
E.coli |
Item no. |
CSB-EP889079HU-50 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
Q9NQB0 |
Gene Names |
TCF7L2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENS SAERDLADVKSSLVNESETNQNSSSDSEAERRPPP RSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPF IMIPDLTSPYLPNGSLSPTARTLHFQSGSTHYSAY KTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDA RSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEH FTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPL SPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPY PTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIV TPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHI KKPLNAFMLYMKEMRAKVVAECTLKESAAINQILG RRWHALSREEQAKYYELARKERQLHMQLYPGWSAR DNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPI |
Expression Region |
1-456aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
54.9 kDa |
Alternative Name(s) |
HMG box transcription factor 4 T-cell-specific transcription factor 4 Short name: T-cell factor 4 Short name: TCF-4 Short name: hTCF-4 |
Relevance |
Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promoters with several copies of the Tcf motif 5'-CCTTTGATC-3' in the presence of CTNNB1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7L2/TCF4 and CTNNB1. Expression of dominant-negative mutants results in cell-cycle arrest in G1. Necessary for the maintenance of the epithelial stem-cell compartment of the small intestine. |
Reference |
"Identification of c-MYC as a target of the APC pathway."He T.-C., Sparks A.B., Rago C., Hermeking H., Zawel L., da Costa L.T., Morin P.J., Vogelstein B., Kinzler K.W.Science 281:1509-1512(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promoters with several copies of the Tcf motif 5'-CCTTTGATC-3' in the presence of CTNNB1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7L2/TCF4 and CTNNB1. Expression of dominant-negative mutants results in cell-cycle arrest in G1. Necessary for the maintenance of the epithelial stem-cell compartment of the small intestine. |
Involvement in disease |
Diabetes mellitus, non-insulin-dependent (NIDDM) |
Subcellular Location |
Nucleus, PML body |
Protein Families |
TCF/LEF family |
Tissue Specificity |
Detected in epithelium from small intestine, with the highest expression at the top of the crypts and a gradient of expression from crypt to villus. Detected in colon epithelium and colon cancer, and in epithelium from mammary gland and carcinomas derived therefrom. |
Paythway |
Hipposignalingpathway |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.