« Back
Home /
Recombinant Human Protein chibby homolog 1(CBY1)

Recombinant Human Protein chibby homolog 1(CBY1)

Item no.	CSB-EP896889HU-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVE LGLEYGSPTMNLAGQSLKFENGQWIAETGVSGGVD RREVQRLRRRNQQLEEENNLLRLKVDILLDMLSES TAESHLMEKELDELRISRKRK
Protein Family	Chibby family
Citations	A novel cytosolic leucine-rich protein. Huang C.-H. Submitted (DEC-2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ARPP-binding protein; Cytosolic leucine-rich protein; PIGEA-14; PKD2 interactor, Golgi and endoplasmic reticulum-associated 1
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	41.5 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Signal Transduction
Relevance	Inhibits the Wnt/Wingless pathway by binding to CTNNB1/beta-catenin and inhibiting beta-catenin-mediated transcriptional activation through competition with TCF/LEF transcription factors. Has also been shown to play a role in regulating the intracellular trafficking of polycystin-2/PKD2 and possibly of other intracellular proteins. Promotes adipocyte and cardiomyocyte differentiation.
Expression Region	1-126aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inhibits the Wnt/Wingless pathway by binding to CTNNB1/beta-catenin and inhibiting beta-catenin-mediated transcriptional activation through competition with TCF/LEF transcription factors. Has also been shown to play a role in regulating the intracellular trafficking of polycystin-2/PKD2 and possibly of other intracellular proteins. Promotes adipocyte and cardiomyocyte differentiation.
Subcellular Location	Nucleus speckle, Cytoplasm, cytoskeleton, cilium basal body, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole, Golgi apparatus, Golgi apparatus, trans-Golgi network
Tissue Specificity	Widely expressed. Expressed at higher levels in heart, skeletal muscle, kidney and placenta. Also found in brain, lung, liver and testis. Significantly down-regulated in thyroid and metastatic uterine tumors.
Gene Names	CBY1
Sequence Info	Full Length
Organism	Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP896889HU-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 9/4/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer