Comparison

Recombinant Human Blood group Rh(D) polypeptide(RHD),partial

Item no. CSB-MP019677HU-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 10 ug 100 ug 1 mg 20 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Conjugate/Tag GST
Purity Greater than 85% as determined by SDS-PAGE.
Sequence LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
Protein Family Ammonium transporter (TC 2.A.49) family, Rh subfamily
Citations "Rh(D) antigen expression and isolation of a new Rh(D) cDNA isoform in human erythroleukemic K562 cells."
Suyama K., Lunn R., Haller S., Goldstein J.
Blood 84:1975-1981(1994)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias RHXIII,Rh polypeptide 2,RhPII,Rhesus D antigen,CD_antigen: CD240D
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
29.6 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Cardiovascular
Relevance
May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Expression Region
388-417aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Subcellular Location
Membrane, Multi-pass membrane protein
Tissue Specificity
Restricted to tissues or cell lines expressing erythroid characters.
Gene Names
RHD
Sequence Info
Partial
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close