« Back
Home /
Recombinant Human Blood group Rh (D) polypeptide (RHD), partial

Recombinant Human Blood group Rh (D) polypeptide (RHD), partial

Item no.	CSB-MP019677HU-1mg
Manufacturer	Cusabio
Amount	1 mg
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug 500 ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Type	Proteins Recombinant
Specific against	other
Conjugate/Tag	GST
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
Citations	"Rh(D) antigen expression and isolation of a new Rh(D) cDNA isoform in human erythroleukemic K562 cells." Suyama K., Lunn R., Haller S., Goldstein J. Blood 84:1975-1981(1994)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	RHXIII Rh polypeptide 2,RhPII Rhesus D antigen CD_antigen: CD240D
Available
Manufacturer - Type	Developed Protein
Manufacturer - Category	Proteins / Recombinant Protein
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Molecular Weight	29.6 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Cardiovascular
Relevance	May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Expression Region	388-417aa
Protein Length	Partial
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function	May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Gene Names	RHD
Organism	Homo sapiens (Human)
Activity	Not Test
Endotoxin	Not test.
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-MP019677HU-1mg-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 11/27/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer