Comparison

Recombinant Mouse Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial(Dlat)

Item no. CSB-MP804374MOe1-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 10 ug 100 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Specific against other
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SLPPHQKVPLPSLSPTMQAGTIARWEKKEGEKISE GDLIAEVETDKATVGFESLEECYMAKILVPEGTRD VPVGSIICITVEKPQDIEAFKNYTLDLAAAAAPQA APAAAPAPAAAPAAPSASAPGSSYPTHMQIVLPAL SPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKAT IGFEVQEEGYLAKILVPEGTRDVPLGAPLCIIVEK QEDIAAFADYRPTEVTSLKPQAAPPAPPPVAAVPP TPQ
Citations "Molecular cloning, and characterization and expression of dihydrolipoamide acetyltransferase component of murine pyruvate dehydrogenase complex in bile duct cancer cells."
Wang L., Kaneko S., Kagaya M., Ohno H., Honda M., Kobayashi K.
J. Gastroenterol. 37:449-454(2002)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex,Pyruvate dehydrogenase complex component E2
Available
Manufacturer - Conjugate / Tag
NO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
58.8 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Signal Transduction
Relevance
The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2, and thereby links the glycolytic pathway to the tricarboxylic cycle.
Expression Region
86-642aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names
Dlat
Sequence Info
Full Length of Mature Protein
Organism
Mus musculus (Mouse)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close