« Back
Home /
Recombinant Human Myosin-9(MYH9) ,partial

Recombinant Human Myosin-9(MYH9) ,partial

Item no.	CSB-RP014054h-200
Manufacturer	Cusabio
Amount	200ug
Quantity options	1mg 10ug 100ug 200ug 50ug 500ug
Category	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cellular myosin heavy chain, type AMyosin heavy chain 9Myosin heavy chain, non-muscle IIaNon-muscle myosin heavy chain A ;NMMHC-ANon-muscle myosin heavy chain IIa ;NMMHC II-a ;NMMHC-IIA
Available
Research areas	Cell Cycle
Target / Protein	MYH9
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P35579
AA Sequence	AQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPS DKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDD IQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYY SGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGK KRHEMPPHIYAITDTAYRSMMQDREDQSILCTGES GAGKTENTKKVIQYLAYVASSHKSKKDQGELERQL LQANPILEAFGNAKTVKNDNSSRFGKFIRI
Tag Info	N-terminal GST-tagged
Expression Region	2-241aa
Protein length	Partial
MW	54.2 kDa
Alternative Name(s)	Cellular myosin heavy chain, type AMyosin heavy chain 9Myosin heavy chain, non-muscle IIaNon-muscle myosin heavy chain A ; NMMHC-ANon-muscle myosin heavy chain IIa ; NMMHC II-a ; NMMHC-IIA
Relevance	Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. During cell spreading, plays an important role in cytoskeleton reorganization, focal contacts formation (in the margins but not the central part of spreading cells), and lamellipodial retraction; this function is mechanically antagonized by MYH10.
References	A genome annotation-driven approach to cloning the human ORFeome.Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I.Genome Biol. 5:R84.1-R84.11(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. During cell spreading, plays an important role in cytoskeleton reorganization, focal contacts formation (in the margins but not the central part of spreading cells), and lamellipodial retraction; this function is mechanically antagonized by MYH10.
Involvement in disease	May-Hegglin anomaly (MHA); Sebastian syndrome (SBS); Fechtner syndrome (FTNS); Epstein syndrome (EPSTNS); Deafness, autosomal dominant, 17 (DFNA17); Macrothrombocytopenia and progressive sensorineural deafness (MPSD)
Subcellular Location	Cytoplasm, cytoskeleton, Cytoplasm, cell cortex
Protein Families	TRAFAC class myosin-kinesin ATPase superfamily, Myosin family
Tissue Specificity	In the kidney, expressed in the glomeruli. Also expressed in leukocytes.
Paythway	Regulationofactincytoskeleton

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time