Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP014054h-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research areas |
Cell Cycle |
Target / Protein |
MYH9 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P35579 |
AA Sequence |
AQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPS DKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDD IQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYY SGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGK KRHEMPPHIYAITDTAYRSMMQDREDQSILCTGES GAGKTENTKKVIQYLAYVASSHKSKKDQGELERQL LQANPILEAFGNAKTVKNDNSSRFGKFIRI |
Tag Info |
N-terminal GST-tagged |
Expression Region |
2-241aa |
Protein length |
Partial |
MW |
54.2 kDa |
Alternative Name(s) |
Cellular myosin heavy chain, type AMyosin heavy chain 9Myosin heavy chain, non-muscle IIaNon-muscle myosin heavy chain A ; NMMHC-ANon-muscle myosin heavy chain IIa ; NMMHC II-a ; NMMHC-IIA |
Relevance |
Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. During cell spreading, plays an important role in cytoskeleton reorganization, focal contacts formation (in the margins but not the central part of spreading cells), and lamellipodial retraction; this function is mechanically antagonized by MYH10. |
References |
A genome annotation-driven approach to cloning the human ORFeome.Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I.Genome Biol. 5:R84.1-R84.11(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. During cell spreading, plays an important role in cytoskeleton reorganization, focal contacts formation (in the margins but not the central part of spreading cells), and lamellipodial retraction; this function is mechanically antagonized by MYH10. |
Involvement in disease |
May-Hegglin anomaly (MHA); Sebastian syndrome (SBS); Fechtner syndrome (FTNS); Epstein syndrome (EPSTNS); Deafness, autosomal dominant, 17 (DFNA17); Macrothrombocytopenia and progressive sensorineural deafness (MPSD) |
Subcellular Location |
Cytoplasm, cytoskeleton, Cytoplasm, cell cortex |
Protein Families |
TRAFAC class myosin-kinesin ATPase superfamily, Myosin family |
Tissue Specificity |
In the kidney, expressed in the glomeruli. Also expressed in leukocytes. |
Paythway |
Regulationofactincytoskeleton |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.