Recombinant Human Myosin-9(MYH9) ,partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Format Liquid
Amount 200ug
Host E.coli
Item no. CSB-RP014054H-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Cell Cycle
Target / Protein
MYH9
Biologically active
Not Test
Species of origin
Homo sapiens (Human)
Uniprot ID
P35579
AA Sequence
AQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPS DKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDD IQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYY SGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGK KRHEMPPHIYAITDTAYRSMMQDREDQSILCTGES GAGKTENTKKVIQYLAYVASSHKSKKDQGELERQL LQANPILEAFGNAKTVKNDNSSRFGKFIRI
Tag info
N-terminal GST-tagged
Expression Region
2-241aa
Protein length
Partial
MW
54.2 kDa
Alternative Name(s)
Cellular myosin heavy chain, type AMyosin heavy chain 9Myosin heavy chain, non-muscle IIaNon-muscle myosin heavy chain A ; NMMHC-ANon-muscle myosin heavy chain IIa ; NMMHC II-a ; NMMHC-IIA
Relevance
Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. During cell spreading, plays an important role in cytoskeleton reorganization, focal contacts formation (in the margins but not the central part of spreading cells), and lamellipodial retraction; this function is mechanically antagonized by MYH10.
Reference
A genome annotation-driven approach to cloning the human ORFeome.Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I.Genome Biol. 5:R84.1-R84.11(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close