Recombinant Human Enhancer of rudimentary homolog(ERH)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 1mg
Host E.coli
ArtNr CSB-RP027444h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Cell Cycle
Uniprot ID
P84090
Gene Names
ERH
Organism
Homo sapiens (Human)
AA Sequence
SHTILLVQPTKRPEGRTYADYESVNECMEGVCKMY EEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLV YRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Expression Region
2-104aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
MW
39.1 kDa
Relevance
May have a role in the cell cycle.
Reference
Cloning and mapping of a novel human cDNA homologous to DROER, the enhancer of the Drosophila melanogaster rudimentary gene.Isomura M., Okui K., Fujiwara T., Shin S., Nakamura Y.Genomics 32:125-127(1996)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,246.43
Price: €1,246.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close