« Back
Home /
Recombinant Human Connective tissue growth factor(CTGF),partial

Recombinant Human Connective tissue growth factor(CTGF),partial

Item no.	CSB-RP094244h-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Category	Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVC TDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKT CACHYNCPGDNDIFESLYYRKMYGDMA
Citations	Connective tissue growth factor a cysteine-rich mitogen secreted by human vascular endothelial cells is related to the SRC-induced immediate early gene product CEF-10.Bradham D.M., Igarashi A., Potter R.L., Grotendorst G.R.J. Cell Biol. 114:1285-1294(1991)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CCN family member 2Hypertrophic chondrocyte-specific protein 24Insulin-like growth factor-binding protein 8 ;IBP-8 ;IGF-binding protein 8 ;IGFBP-8
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	MW of Fusion: 38, 1
General Research Areas	Immunology
Relevance	Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.
Expression Region	253-349aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names	CTGF
Sequence Info	Partial
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 9/18/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer