Comparison

Recombinant Human Connective tissue growth factor(CTGF),partial

Item no. CSB-RP094244h-50
Manufacturer Cusabio
Amount 50 ug
Quantity options 1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host E.coli
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVC TDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKT CACHYNCPGDNDIFESLYYRKMYGDMA
Citations Connective tissue growth factor a cysteine-rich mitogen secreted by human vascular endothelial cells is related to the SRC-induced immediate early gene product CEF-10.Bradham D.M., Igarashi A., Potter R.L., Grotendorst G.R.J. Cell Biol. 114:1285-1294(1991)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CCN family member 2Hypertrophic chondrocyte-specific protein 24Insulin-like growth factor-binding protein 8 ;IBP-8 ;IGF-binding protein 8 ;IGFBP-8
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
MW of Fusion: 38, 1
General Research Areas
Immunology
Relevance
Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.
Expression Region
253-349aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names
CTGF
Sequence Info
Partial
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close