« Back
Home /
Recombinant Danio rerio COP9 signalosome complex subunit 2(cops2)

Recombinant Danio rerio COP9 signalosome complex subunit 2(cops2)

Item no.	CSB-YP753713DIL-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQ YYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFK ALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTR NYSEKSINSILDYISTSKQMDLLQEFYETTLEALK DAKNDRLWFKTNTKLGKLYLEREEFGKLQKILRQL HQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKN NKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMH LRE
Protein Family	CSN2 family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	csn2
Available
Manufacturer - Targets	cops2
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	53.6 kDa
General Research Areas	Signal Transduction
Relevance	Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of E3 ligase complexes, leading to modify the Ubl ligase activity.
Expression Region	1-443aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of E3 ligase complexes, leading to modify the Ubl ligase activity.
Subcellular Location	Cytoplasm, Nucleus
Biologically active	Not Test
Protein length	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP753713DIL-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer