« Back
Home /
Recombinant Mouse Macrophage migration inhibitory factor (Mif)

Recombinant Mouse Macrophage migration inhibitory factor (Mif)

Item no.	CSB-EP013826MO-100ug
Manufacturer	Cusabio
Amount	100 ug
Quantity options	10 ug 100 ug 1 mg 200 ug 20 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Citations	"Purification, bioactivity, and secondary structure analysis of mouse and human macrophage migration inhibitory factor (MIF)." Bernhagen J., Mitchell R.A., Calandra T., Voelter W., Cerami A., Bucala R. Biochemistry 33:14144-14155(1994)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Delayed early response protein 6 (DER6) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase (EC:5.3.3.12)) (Phenylpyruvate tautomerase) (MIF)
Available
Manufacturer - Type	In Stock Protein
Manufacturer - Category	Proteins / Recombinant Protein
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Molecular Weight	18.4 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Immunology
Relevance	Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity, but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
Expression Region	2-115aa
Protein Length	Full Length of Mature Protein
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Gene Names	Mif
Organism	Mus musculus (Mouse)
Activity	Not Test
Endotoxin	Not test.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP013826MO-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 7/3/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail