Item no. |
CSB-EP013826MO-200 |
Manufacturer |
Cusabio
|
Amount |
200 ug |
Quantity options |
10 ug
100 ug
1 mg
200 ug
20 ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
Mouse (Murine, Mus musculus) |
Host |
E.coli |
Conjugate/Tag |
HIS |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Sequence |
PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQ YIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGA QNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAAN VGWNGSTFA |
Citations |
Purification, bioactivity, and secondary structure analysis of mouse and human macrophage migration inhibitory factor (MIF). Bernhagen J., Mitchell R.A., Calandra T., Voelter W., Cerami A., Bucala R. Biochemistry 33:14144-14155(1994) |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Delayed early response protein 6 (DER6) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase (EC:5.3.3.12)) (Phenylpyruvate tautomerase) (MIF) |
Available |
|
Manufacturer - Conjugate / Tag |
N-terminal 10xHis-tagged |
Storage Conditions |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Molecular Weight |
18.4 kDa |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
General Research Areas |
Immunology |
Relevance |
Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity, but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity. |
Biologically Active |
Not Test |
Expression Region |
2-115aa |
Protein Length |
Full Length of Mature Protein |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.