« Back
Home /
Recombinant Human Programmed cell death protein 10(PDCD10)

Recombinant Human Programmed cell death protein 10(PDCD10)

Item no.	CSB-EP861141HU-20
Manufacturer	Cusabio
Amount	20 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELER VNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKK SVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNE KARALKQILSKIPDEINDRVRFLQTIKDIASAIKE LLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFS DTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT VA
Protein Family	PDCD10 family
Citations	cDNA cloning and expression of an apoptosis-related gene, human TFAR-15 gene.Wang Y.G., Liu H.T., Ma D.L., Zhang Y.M.Sci. China, Ser. C, Life Sci. 42:323-329(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cerebral cavernous malformations 3 protein;TF-1 cell apoptosis-related protein 15
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	40.7 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Signal Transduction
Relevance	Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and STK26 activity. Important for cell migration, and for normal structure and assbly of the Golgi complex. Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hatopoiesis during bryonic development .
Expression Region	1-212aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and STK26 activity
Subcellular Location	Cytoplasm, Golgi apparatus membrane, Peripheral membrane protein, Cytoplasmic side, Cell membrane, Peripheral membrane protein, Cytoplasmic side
Tissue Specificity	Ubiquitous.
Involvement in disease	Cerebral cavernous malformations 3 (CCM3)
Gene Names	PDCD10
Sequence Info	Full Length
Organism	Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP861141HU-20-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time