Comparison

Recombinant Human S100-A12 Protein European Partner

Item no. RP00009-100ug
Manufacturer Abclonal
Amount 100 ug
Quantity options 100 ug 200 ug 20 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 97% by SDS-PAGE.
Sequence MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
NCBI S100-A12
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias S100A12,CAAF1,CAGC,CGRP,ENRAGE,MRP-6,MRP6,p6
Similar products CGRP, MRP6, p6, CAAF1, CAGC, ENRAGE, MRP-6
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
11.42 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human S100-A12 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu92) of human S100A12 (Accession #NP_005612.1) fused with a 6×His tag at the C-terminus.
Background
The protein is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 proteins include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Met1-Glu92
Route
C-His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Other Recombinant Protein
Antigen Seq
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human S100A12 Protein at 2 μg/mL (100 μL/well) can bind AGER with a linear range of 1. 95-14. 13 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
11.42 kDa
Gene Symbol
S100-A12

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close