« Back
Home /
Recombinant Human FGF-21 Protein

Recombinant Human FGF-21 Protein

Item no.	RP00049-20ug
Manufacturer	Abclonal
Amount	20 ug
Quantity options	100 ug 10 ug 20 ug 50 ug 5 ug
Category	Oncology Neuroscience Metabolism Diabetes Glucose Homeostasis Neural Signaling By Cell Type Carcinoma Hematology Myeloma Peptides & Proteins Recombinant Proteins Cell Biology Obesity Cell Culture Cytokines
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
NCBI	FGF-21
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	FGF21,fibroblast growth factor 21
Similar products	FGF21, FGF-21, fibroblast growth factor 21
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	19.41 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human FGF-21 Protein is produced by E. coli expression system. The target protein is expressed with sequence (His29-Ser209) of human FGF-21 (Accession #NP_061986.1).
Background	This protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. This protein is a secreted endocrine factor that functions as a major metabolic regulator. The protein stimulates the uptake of glucose in adipose tissue.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	His29-Ser209
Route	No tag
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Growth Factor
Antigen Seq	HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Expected Protein Size	19.41 kDa
Gene Symbol	FGF-21

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00049-20ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer