Comparison

Recombinant Human FGF-21 Protein European Partner

Item no. RP00049-100ug
Manufacturer Abclonal
Amount 100 ug
Quantity options 100 ug 10 ug 20 ug 50 ug 5 ug
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE.
NCBI FGF-21
Alias FGF21,fibroblast growth factor 21
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
19.41 kDa
Description
Recombinant Human FGF-21 Protein is produced by E. coli expression system. The target protein is expressed with sequence (His29-Ser209) of human FGF-21 (Accession #NP_061986.1).
Background
This protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. This protein is a secreted endocrine factor that functions as a major metabolic regulator. The protein stimulates the uptake of glucose in adipose tissue.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
His29-Ser209
Route
No tag
Manufacturer - Research Area
Growth Factor
Antigen Seq
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Expected Protein Size
19.41 kDa
Gene Symbol
FGF-21

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close