« Back
Home /
Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein

Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein

Item no.	RP00075-100ug
Manufacturer	Abclonal
Amount	100 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 500 ug 50 ug 5 ug
Category	Oncology By Cell Type Hematology Leukemia Lymphoma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 97% by SDS-PAGE.
Sequence	APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP
NCBI	Fc-gamma RIIb/CD32b
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	FCGR2B,CD32,CD32B,FCG2,FCGR2,IGFR2
Similar products	CD32, FCG2, IGFR2, FCGR2, CD32B
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	20.17 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala46-Pro217) of human Fc gamma RIIB/C (Accession #NP_003992.3) fused with a 6×His tag at the C-terminus.
Background	The protein is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ala46-Pro217
Route	C-His
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Fc & Fc Receptor, Bio-Markers & CD Antigens, Biosimilar Drug Targets
Antigen Seq	APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP
Bioactivity	1. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human FCGR2B at 2 μg/mL (100 μL/well) can bind biotinylated Human IgG1 with a linear range of 0. 0048-2. 81 μg/mL.\|2. Measured by its binding ability in a functional ELISA. Immobilized Human FCGR2B (Catalog:RP00075) at 2μg/mL (100 μL/well) can bind FCGR2B Rabbit pAb (Catalog: A12553) with a linear range of 0. 3-77. 48ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	20.17 kDa
Gene Symbol	Fc-gamma RIIb/CD32b

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00075-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer