Comparison

Recombinant Human IL-17A/CTLA-8 Protein European Partner

Item no. RP00212-100ug
Manufacturer Abclonal
Amount 100 ug
Quantity options 100 ug 10 ug 20 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Sequence IVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
NCBI IL-17A/CTLA-8
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias IL17A,CTLA-8,CTLA8,IL-17,IL-17A,IL17,interleukin-17A,CTLA-8,CTLA8,IL-17,IL-17A,IL17
Similar products IL17A, CTLA8, IL17
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
16.37 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human IL-17A/CTLA-8 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile20-Ala155) of human IL-17A (Accession #NP_002181.1) fused with a 6×His tag at the C-terminus.
Background
IL17, also known as IL17a and CTLA8, is a is a 15-20 kDa glycosylated cytokine which belongs to the IL-17 family. The IL-17 family of cytokines includes six members, IL-17/IL-17A, IL-17B, IL-17C, IL-17D, IL-17E/IL-25, and IL-17F, which are produced by multiple cell types. IL17A promotes protective mucosal and epidermal inflammation in response to microbial infection .It induces chemokine production, neutrophil influx, and the production of antibacterial peptides .IL17A additionally enhances the production of inflammatory mediators by rheumatoid synovial fibroblasts and contributes to TNF alpha induced shock . In contrast, it can protect against the progression of colitis by limiting chronic inflammation . IL17A encourages the formation of autoreactive germinal centers and exacerbates the onset and progression of experimental models of autoimmunity .
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ile20-Ala155
Route
C-His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Interleukin, Biosimilar Drug Targets
Antigen Seq
IVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized Recombinant human IL17RA at 2 μg/mL (100 μL/well) can bind Recombinant human IL-17A, the EC50 of human IL-17A is 32. 5-130 ng/mL.|2. Measured by its ability to induce IL-6 secretion by Hela cells. The ED50 for this effect is 2. 64-10. 58 ng/mL, corresponding to a specific activity of 9. 45×104~3. 79×105 units/mg.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
16.37 kDa
Gene Symbol
IL-17A/CTLA-8

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close