Comparison

Recombinant Mouse TNFRSF3/Lymphotoxin beta R Protein European Partner

Item no. RP00599-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 10 ug 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
Sequence SQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEP
NCBI TNFRSF3/Lymphotoxin beta R
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Tumor necrosis factor receptor superfamily member 3,Lymphotoxin-betareceptor,Ltbr,Tnfcr,Tnfrsf3
Available
Manufacturer - Category
Proteins
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
It is a single-pass type I membrane protein and contains 4 TNFR-Cys repeats. The protein is a member of thetumor necrosis factor (TNF) family of receptors. It is expressed on the surface of most cell types, including cellsof epithelial and myeloid lineages, but not on T and B lymphocytes. The protein is the receptor for theheterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. It promotes apoptosis via TRAF3and TRAF5 and may play a role in the development of lymphoid organs. The encoded protein and its ligandplay a role in the development and organization of lymphoid tissue and transformed cells. Activation of theencoded protein can trigger apoptosis. Not only does the TNFRSF3 help trigger apoptosis, it can lead to therelease of the cytokine interleukin 8. Overexpression of TNFRSF3 in Human Cells cells increases IL-8 promoteractivity and leads to IL-8 release. TNFRSF3 is also essential for development and organization of the secondarylymphoid organs and chemokine release.
Immunogen
Ser28-Pro218
Route
C-Fc
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine Receptors
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close