Recombinant Human/Mouse/Rat mature TGF-beta 3 Protein

Proteins

Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.

Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.

Transforming growth factor beta 3(TGFB3) is a member of a TGF - β superfamily which is defined bytheirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form ofTGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subsetofintegrins. It binds with high affinity to TGF- β RII, a type II serine/threonine kinase receptor. TGFB3 is involvedincell differentiation, embryogenesis and development.It is believed to regulate molecules involved incellularadhesion and extracellular matrix (ECM) formation during the process of palate development. WithoutTGF-β3, mammals develop a deformity known as a cleft palate.

Ala301-Ser412(Y340F)

< 1 EU/μg of the protein by LAL method.

ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS

Lyophilized from a 0.2 μm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH 2.5. Contact us for customized product form or formulation.

TGF-beta 3