Comparison

Recombinant Human/Mouse/Rat mature TGF-beta 3 Protein European Partner

Item no. RP00645-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Sequence ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NCBI TGF-beta 3
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias TGFB3,ARVD,ARVD1,LDS5,RNHF,TGF-beta3
Similar products TGFB3, Latency-associated peptide, LAP, TGF-beta-3, Transforming growth factor beta-3
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
12.70 kDa
Manufacturer - Additional Information
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human/Mouse/Rat TGF-beta 3 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala301-Ser412(Tyr340Phe)) of human TGF-beta 3/TGFB3 (Accession #P10600).
Background
Transforming growth factor beta 3(TGFB3) is a member of a TGF - β superfamily which is defined bytheirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form ofTGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subsetofintegrins. It binds with high affinity to TGF- β RII, a type II serine/threonine kinase receptor. TGFB3 is involvedincell differentiation, embryogenesis and development.It is believed to regulate molecules involved incellularadhesion and extracellular matrix (ECM) formation during the process of palate development. WithoutTGF-β3, mammals develop a deformity known as a cleft palate.
Manufacturer - Cross Reactivity
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ala301-Ser412(Y340F)
Route
No tag
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine receptors
Antigen Seq
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
Bioactivity
Measured by its ability to inhibit the IL-4-dependent proliferation of HT-2 mouse T cells. The ED50 for this effect is 24. 2-96. 6 pg/mL, corresponding to a specific activity of 1. 04×107~4. 17×107 units/mg.
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH 2.5. Contact us for customized product form or formulation.
Expected Protein Size
12.70 kDa
Gene Symbol
TGF-beta 3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close