« Back
Home /
Recombinant Mouse IFNA2/IFN-alpha 2 Protein

Recombinant Mouse IFNA2/IFN-alpha 2 Protein

Item no.	RP00688-500ug
Manufacturer	Abclonal
Amount	500 ug
Quantity options	1000 ug 10 ug 500 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Purity	> 95% by SDS-PAGE.
Sequence	CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE
NCBI	IFNA2/IFN-alpha 2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interferon Alpha-2,IFN-Alpha-2,Interferon Alpha-A,LeIF A,IFNA2
Available
Manufacturer - Category	Proteins
Storage Conditions	This product is stable at ≤ -70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in 1X PBS.
Background	At least 23 different variants of Interferon- α are known. The individual proteins have molecular massesbetween 19-26 kD and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN- α subtypespossess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN- α subtypes differ in their sequences at only one or two positions.Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxyl-terminal end.
Immunogen	Cys24-Glu190
Route	No tag
Endotoxin	< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Cytokines & Cytokine Receptors
Protein Formulation	Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 6/5/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail