Comparison

Recombinant Mouse IFNA2/IFN-alpha 2 Protein European Partner

Item no. RP00688-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
Sequence CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE
NCBI IFNA2/IFN-alpha 2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interferon Alpha-2,IFN-Alpha-2,Interferon Alpha-A,LeIF A,IFNA2
Available
Manufacturer - Category
Proteins
Storage Conditions
This product is stable at ≤ -70°C for up to 1 year from the date of receipt.|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in 1X PBS.
Background
At least 23 different variants of Interferon- α are known. The individual proteins have molecular massesbetween 19-26 kD and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN- α subtypespossess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN- α subtypes differ in their sequences at only one or two positions.Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxyl-terminal end.
Immunogen
Cys24-Glu190
Route
No tag
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine Receptors
Protein Formulation
Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close