Comparison

Recombinant Mouse TNFSF9/4-1BB Ligand Protein European Partner

Item no. RP00766-1000ug
Manufacturer Abclonal
Amount 1000 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Host Mouse
Purity > 95% by SDS-PAGE.
Sequence RTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE
NCBI TNFSF9/4-1BB Ligand
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Tumor necrosis factor ligand superfamily member 9,4-1BB ligand,4-1BBL,Tnfsf9,Cd137l,Cd157l,Ly63l,TNFSF9
Similar products 4-1BBL, Tnfsf9, Tumor necrosis factor ligand superfamily member 9, 4-1BB ligand, Cd137l, Cd157l, Ly63l
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
23.80 kDa
Manufacturer - Additional Information
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Mouse TNFSF9/4-1BB Ligand Protein is produced by Human cells expression system. The target protein is expressed with sequence (Arg104-Glu309) of mouse TNFSF9/4-1BB Ligand (Accession #P41274) fused with aHis tag at the N-terminus.
Background
Tumor necrosis factor ligand superfamily member 9, also known as 4-1BBL, is a member of the the tumornecrosis factor family. Mouse 4-1BBL cDNA encodes a 309 amino acid residues (aa) protein with an 82 aa N-terminal cytoplasmic domain, a 21 aa transmembrane domain and a 206 aa C-terminal extracellular domain.The extracellular domain of 4-1BBL has a tertiary structure similar to that of other TNFSF members, but sharesonly low aa sequence homology (14-16%). 4-1BBL is predominantly expressed on activated antigen presentingcells (APCs) such as B cells, macrophages and dendritic cells (DCs). It is also expressed on most T and Blymphoma cell lines. TNFSF9 has been shown to reactivate anergic T lymphocytes in addition to promoting Tlymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses inCD8 T cells, and is thought to be involved in T cell-tumor cell interaction.
Manufacturer - Cross Reactivity
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Arg104-Glu309
Route
N-His
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine receptors
Antigen Seq
RTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Mouse TNFSF9(Catalog: RP00766) at 5μg/mL (100 μL/well) can bind Mouse TNFRSF9/4-1BB/CD137(Catalog: RP01560) with a linear range of 0. 01-1. 41 ng/mL.
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Expected Protein Size
23.80 kDa
Gene Symbol
TNFSF9/4-1BB Ligand

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 ug
Available: In stock
available

Delivery expected until 7/31/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close