Recombinant Mouse TNFSF9/4-1BB Ligand Protein

Proteins

Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.

Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.

Tumor necrosis factor ligand superfamily member 9, also known as 4-1BBL, is a member of the the tumornecrosis factor family. Mouse 4-1BBL cDNA encodes a 309 amino acid residues (aa) protein with an 82 aa N-terminal cytoplasmic domain, a 21 aa transmembrane domain and a 206 aa C-terminal extracellular domain.The extracellular domain of 4-1BBL has a tertiary structure similar to that of other TNFSF members, but sharesonly low aa sequence homology (14-16%). 4-1BBL is predominantly expressed on activated antigen presentingcells (APCs) such as B cells, macrophages and dendritic cells (DCs). It is also expressed on most T and Blymphoma cell lines. TNFSF9 has been shown to reactivate anergic T lymphocytes in addition to promoting Tlymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses inCD8 T cells, and is thought to be involved in T cell-tumor cell interaction.

Arg104-Glu309

< 1 EU/μg of the protein by LAL method.

RTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

TNFSF9/4-1BB Ligand