« Back
Home /
Recombinant Human ALK-1/ACVRL1 Protein

Recombinant Human ALK-1/ACVRL1 Protein

Item no.	RP00978-10ug
Manufacturer	Abclonal
Amount	10 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ
NCBI	ALK-1/ACVRL1
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ACVRL1,ACVRLK1,ALK-1,ALK1,HHT,HHT2,ORW2,SKR3,TSR-I,ALK-1,ALK1,HHT,HHT2,ORW2,SKR3,TSR-I
Similar products	ACVRLK1, ALK1, HHT2, ALK-1, HHT, ORW2, SKR3, TSR-I
Shipping Condition	Cool pack
Available
Manufacturer - Applications	Please contact us for more information.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	11.55 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human ALK-1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asp22-Gln118) of human ALK-1 (Accession #NP_000011.2) fused with a 6×His tag at the C-terminus.
Background	This protein is a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Asp22-Gln118
Route	C-His
Manufacturer - Research Area	Cytokines & Cytokine receptors, Biosimilar Drug Targets
Antigen Seq	DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human ALK-1 at 4 μg/mL (100 μL/well) can bind Human ACVR2B with a linear range of 0. 08-2. 4 μg/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	11.55 kDa
Gene Symbol	ALK-1/ACVRL1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00978-10ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer