Comparison

Recombinant Human Ephrin-A3/EFNA3 Protein European Partner

Item no. RP01022-5ug
Manufacturer Abclonal
Amount 5 ug
Quantity options 100 ug 10 ug 20 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
NCBI Ephrin-A3/EFNA3
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias EFNA3,EFL2,EPLG3,Ehk1-L,LERK3,ephrin-A3
Similar products EFL2, EPLG3, Ehk1-L, LERK3
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
50.45 kDa
Description
Recombinant Human Ephrin-A3/EFNA3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1-Ser 213) of human Ephrin A3 (Accession #NP_004943.1) fused with an Fc, 6×His tag at the C-terminus.
Immunogen
Met1-Ser213
Route
C-hFc&His
Manufacturer - Research Area
Other Recombinant Protein
Revised name
EFL2, Ehk1-L, EPLG3, LERK3
Antigen Seq
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS
Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized Mouse EPHA6 at 1 μg/mL (100 μL/well) can bind Human EphrinA3 with a linear range of 0. 3-113. 9 ng/mL.|2. Measured by its binding ability in a functional ELISA.Immobilized Mouse EPHA6 at 1μg/mL (100 μL/well) can bind Human EphrinA3 with a linear range of 0. 3-59 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
50.45 kDa
Gene Symbol
Ephrin-A3/EFNA3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close