Comparison

Recombinant Human EGF Protein European Partner

Item no. RP01030-200ug
Manufacturer Abclonal
Amount 200 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 90% by SDS-PAGE.
NCBI EGF
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias EGF,HOMG4,URG
Similar products HOMG4, URG, Epidermal Growth Factor
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
33.01 kDa
Description
Recombinant Human EGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn 971-Arg 1023) of human EGF (Accession #NP_001954.2) fused with hFc, 6×His tag at the C-terminus.
Background
Epidermal growth factor (EGF) is the founding member of the EGF family that also includes TGF-alpha, amphiregulin (AR), betacellulin (BTC), epiregulin (EPR), heparin binding EGF like growth factor (HB_x005f
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Asn971-Arg1023
Route
C-hFc&His
Manufacturer - Research Area
Growth Factor, Cell Culture related
Revised name
Epidermal Growth Factor, HOMG4, URG
Antigen Seq
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Bioactivity
1. Measured by its ability to stimulate EGF Receptor autophosphorylation in A431 cells.1-10 ng/mL of Recombinant Human EGF can effectively enhance EGF Receptor autophosphorylation.|2. Measured by its binding ability in a functional ELISA. Immobilized Human EGFR at 5 μg/mL (100 μL/well) can bind Human EGF with a linear range of 7-25 ng/mL. 3. Measured in a cell proliferation assay using BALB/c 3T3 mouse embryonic fibroblasts. The ED50 for this effect is typically 0. 065-0. 26 ng/mL, corresponding to a specific activity of 3. 84×106-1. 54×107units/mg.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
33.01 kDa
Gene Symbol
EGF

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close