« Back
Home /
Recombinant Human VEGF-A/VEGF121 Protein

Recombinant Human VEGF-A/VEGF121 Protein

Item no.	RP01162-200ug
Manufacturer	Abclonal
Amount	200 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Category	Oncology By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines Adenocarcinoma By Organ Bladder Cancer
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
NCBI	VEGF-A/VEGF121
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	VEGFA,MVCD1,VEGF,VPF,vascular endothelial growth factor A,MVCD1,VEGF,VPF,L VEGFA,VEGF A
Similar products	VEGF, VPF, MVCD1
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	14.91 kDa
Description	Recombinant Human VEGF-A/VEGF121 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala27-Arg147) of human VEGF121 (Accession #NP_001165099.1) fused with a 6×His tag at the N-terminus.
Background	This protein is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This protein is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ala27-Arg147
Route	N-His
Manufacturer - Research Area	Growth Factor, Cell Culture related, Biosimilar Drug Targets
Revised name	MVCD1, VEGF, VPF
Antigen Seq	APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
Bioactivity	1. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human VEGF121 at 1 μg/mL (100 μL/well) can bind Recombinant Human VEGFR2 with a linear range of 4-10 ng/mL.\|2. Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ for this effect is 0. 09-0. 36 ng/mL.\|3. Recombinant Human VEGFA(40 ng/mL) and bFGF(50 ng/mL, Cat. RP01162) induce mesoderm cells to differentiate into hematopoietic stem and progenitor cells. After 4 days induction, pebbly-like CD43+ hematopoietic stem and progenitor cells appeared in the hematogenic endothelium.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	14.91 kDa
Gene Symbol	VEGF-A/VEGF121

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01162-200ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer