Comparison

Recombinant Human VEGF-A/VEGF121 Protein European Partner

Item no. RP01162-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Sequence APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
NCBI VEGF-A/VEGF121
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias VEGFA,MVCD1,VEGF,VPF,vascular endothelial growth factor A,MVCD1,VEGF,VPF,L VEGFA,VEGF A
Similar products VEGF, VPF, MVCD1
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
14.91 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human VEGF-A/VEGF121 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala27-Arg147) of human VEGF121 (Accession #NP_001165099.1) fused with a 6×His tag at the N-terminus.
Background
This protein is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This protein is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ala27-Arg147
Route
N-His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Growth Factor, Cell Culture related, Biosimilar Drug Targets
Antigen Seq
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human VEGF121 at 1 μg/mL (100 μL/well) can bind Recombinant Human VEGFR2 with a linear range of 4-10 ng/mL.|2. Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 0. 09-0. 36 ng/mL.|3. Recombinant Human VEGFA(40 ng/mL) and bFGF(50 ng/mL, Cat. RP01162) induce mesoderm cells to differentiate into hematopoietic stem and progenitor cells. After 4 days induction, pebbly-like CD43+ hematopoietic stem and progenitor cells appeared in the hematogenic endothelium.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
14.91 kDa
Gene Symbol
VEGF-A/VEGF121

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
Recently viewed
 
Close