« Back
Home /
Recombinant HCoV-OC43 Hemagglutinin esterase/HE Protein

Recombinant HCoV-OC43 Hemagglutinin esterase/HE Protein

Item no.	RP01301LQ-100ug
Manufacturer	Abclonal
Amount	100 ug
Quantity options	100 ug 10 ug 500 ug 5 ug
Category	Infectious Diseases Viral Infections Coronavirus (COVID-19) Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	Coronavirus
Conjugate/Tag	HIS
Purity	> 95% by SDS-PAGE.
Dry ice	Yes
Sequence	LGFYNPPTNVVSHVNGDWFLFGDSRSDCNHIVNINPHNYSYMDLNPVLCDSGKISSKAGNSIFRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCNRSGSNDIWMQNKGLFYTQVYKNMAVYRSLTFVNVPYVYNGSAQATALCKSGSLVLNNPAYIAPQANSGDYYYKVEADFYLSGCDEYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDLNCYYLVLPSGNYLAISNELLLTVP
NCBI	HCoV-OC43 Hemagglutinin esterase/HE
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Hemagglutinin esterase (HE) ,Hemagglutinin esterase (HE)
Shipping Condition	Dry ice
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Manufacturer - Host	HCoV-OC43
Shipping Temperature	dry ice
Storage Conditions	Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Protein Weight	43.30 kDa
Description	Recombinant HCoV-OC43 Coronavirus Hemagglutinin esterase Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu17-Val392) of hcov-oc43 Coronavirus Hemagglutinin esterase (Accession #YP_009555240.1) fused with a 6×His tag at the C-terminus.
Immunogen	Leu17-Val392
Route	C-His
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Coronavirus antigens
Antigen Seq	LGFYNPPTNVVSHVNGDWFLFGDSRSDCNHIVNINPHNYSYMDLNPVLCDSGKISSKAGNSIFRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCNRSGSNDIWMQNKGLFYTQVYKNMAVYRSLTFVNVPYVYNGSAQATALCKSGSLVLNNPAYIAPQANSGDYYYKVEADFYLSGCDEYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDLNCYYLVLPSGNYLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNSTTNYVGVYDINHGDAGFTSILSGLLYNSPCFSQQGVFRYDNVSSVWPLYPYGRCPTAADINIPDLPICVYDPLPV
Protein Formulation	Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.
Expected Protein Size	43.30 kDa
Gene Symbol	HCoV-OC43 Hemagglutinin esterase/HE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01301LQ-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 11/27/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer