Comparison

Recombinant HCoV-OC43 Hemagglutinin esterase/HE Protein European Partner

Item no. RP01301LQ-5ug
Manufacturer Abclonal
Amount 5 ug
Quantity options 100 ug 10 ug 500 ug 5 ug
Category
Type Proteins Recombinant
Specific against Coronavirus
Purity > 95% by SDS-PAGE.
Dry ice Yes
NCBI HCoV-OC43 Hemagglutinin esterase/HE
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Hemagglutinin esterase (HE) ,Hemagglutinin esterase (HE)
Shipping Condition Dry ice
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Manufacturer - Host
HCoV-OC43
Shipping Temperature
dry ice
Storage Conditions
Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Protein Weight
43.30 kDa
Description
Recombinant HCoV-OC43 Coronavirus Hemagglutinin esterase Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu17-Val392) of hcov-oc43 Coronavirus Hemagglutinin esterase (Accession #YP_009555240.1) fused with a 6×His tag at the C-terminus.
Immunogen
Leu17-Val392
Route
C-His
Manufacturer - Research Area
Coronavirus antigens
Revised name
Hemagglutinin esterase(HE)
Antigen Seq
LGFYNPPTNVVSHVNGDWFLFGDSRSDCNHIVNINPHNYSYMDLNPVLCDSGKISSKAGNSIFRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCNRSGSNDIWMQNKGLFYTQVYKNMAVYRSLTFVNVPYVYNGSAQATALCKSGSLVLNNPAYIAPQANSGDYYYKVEADFYLSGCDEYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDLNCYYLVLPSGNYLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNSTTNYVGVYDINHGDAGFTSILSGLLYNSPCFSQQGVFRYDNVSSVWPLYPYGRCPTAADINIPDLPICVYDPLPV
Protein Formulation
Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.
Expected Protein Size
43.30 kDa
Gene Symbol
HCoV-OC43 Hemagglutinin esterase/HE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close