Comparison

Recombinant Human PDGF-BB Protein European Partner

Item no. RP01763-20ug
Manufacturer Abclonal
Amount 20 ug
Quantity options 100 ug 10 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Sequence SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
NCBI PDGF-BB
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias SIS,SSV,IBGC5,PDGF2,c-sis,PDGF-2,PDGF subunit B,PDGF-BB,PDGFB
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.1EU/μg
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
12.30 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human PDGF-BB Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser82-Thr190) of human PDGF-BB (Accession #NP_002599.1) fused with a additional amino acid free.
Background
Platelet-derived growth factor-B (PDGFB) is necessary for normal cardiovascular development. The administration of PDGFB alone normalized tumor vasculature by increasing periendothelial coverage and vascular functionality. Interestingly, this effect exerted by PDGFB was also observed in the presence of DAPT. So PDGFB is able to improve tumor vascularity and allows the anticancer action of DAPT in the tumor.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ser82-Thr190
Recommended Dilution
Lyophilized from a 0.22 μm filtered solution of 20mM NaAc,pH 4.5.
Route
No-tag
Endotoxin
< 0.1EU/μg
Manufacturer - Research Area
Cytokines & Cytokine receptors
Antigen Seq
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Bioactivity
1. Immobilized PDGF-BB (Catalog: RP01763) at 2 μg/mL (100 μL/well) can bind Human PDGFRB (Catalog: RP00126) with a linear range of 0. 1-75. 4 ng/mL.2. Recombinant Human PDGF-BB Protein was measured in a cell proliferation assay using BALB/3T3 mouse fibroblasts. The ED50 for this effect is 2. 09-8. 36 ng/mL, corresponding to a specific activity of 1. 20×105~4. 78×105 units/mg.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of 20mM NaAc,pH 4.5.
Expected Protein Size
12.30 kDa
Gene Symbol
PDGF-BB

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close