« Back
Home /
Recombinant Human PDGF-BB Protein

Recombinant Human PDGF-BB Protein

Item no.	RP01763-50ug
Manufacturer	Abclonal
Amount	50 ug
Quantity options	100 ug 10 ug 20 ug 50 ug
Category	Oncology By Cell Type Blastoma Carcinoma Glioma Sarcoma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
NCBI	PDGF-BB
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SIS,SSV,IBGC5,PDGF2,c-sis,PDGF-2,PDGF subunit B,PDGF-BB,PDGFB
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1EU/μg
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	12.30 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human PDGF-BB Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser82-Thr190) of human PDGF-BB (Accession #NP_002599.1) fused with a additional amino acid free.
Background	Platelet-derived growth factor-B (PDGFB) is necessary for normal cardiovascular development. The administration of PDGFB alone normalized tumor vasculature by increasing periendothelial coverage and vascular functionality. Interestingly, this effect exerted by PDGFB was also observed in the presence of DAPT. So PDGFB is able to improve tumor vascularity and allows the anticancer action of DAPT in the tumor.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ser82-Thr190
Route	No-tag
Endotoxin	< 0.1EU/μg
Manufacturer - Research Area	Cytokines & Cytokine receptors
Antigen Seq	SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Bioactivity	1. Immobilized PDGF-BB (Catalog: RP01763) at 2 μg/mL (100 μL/well) can bind Human PDGFRB (Catalog: RP00126) with a linear range of 0. 1-75. 4 ng/mL.2. Recombinant Human PDGF-BB Protein was measured in a cell proliferation assay using BALB/3T3 mouse fibroblasts. The ED50 for this effect is 2. 09-8. 36 ng/mL, corresponding to a specific activity of 1. 20×105~4. 78×105 units/mg.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 20mM NaAc，pH 4.5.
Expected Protein Size	12.30 kDa
Gene Symbol	PDGF-BB

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01763-50ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 11/27/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer