« Back
Home /
Recombinant Human Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein

Recombinant Human Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein

Item no.	RP02008-500ug
Manufacturer	Abclonal
Amount	500 ug
Quantity options	1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
NCBI	Angiopoietin-2/ANGPT2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	AGPT2,ANG2,ANGPT2,ANG2
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	26.30 kDa
Description	Recombinant Human Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein is produced by mammalian expression system. The target protein is expressed with sequence (Lys275-Phe496) of human Angiopoietin-2/ANGPT2 (Accession #O15123) fused with 6xHis at the C-terminus.
Background	Angiopoietin-2 (Ang-2; also ANGPT2) is a secreted glycoprotein that plays a complex role in angiogenesis and inflammation . Mature Ang-2 is 478 amino acids in length.Ang2 is widely expressed during development, but it is restricted postnatally to highly angiogenic tissues such as the placenta, ovaries, and uterus. It is particularly abundant in vascular endothelial cells (EC) where it is stored in intracellular Weibel Palade bodies.
Manufacturer - Cross Reactivity	Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Lys275-Phe496
Route	C-His
Manufacturer - Research Area	Growth Factor, Biosimilar Drug Targets
Revised name	AGPT2, ANG2
Antigen Seq	KEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 20mM MOPS 150 mM NaCl 0.05% CHAPS pH 7.0.
Expected Protein Size	26.30 kDa
Gene Symbol	Angiopoietin-2/ANGPT2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP02008-500ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 9/18/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer