Comparison

Recombinant Human Macrophage migration inhibitory factor/MIF Protein European Partner

Item no. RP02895LQ-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 10 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 95% by reducing SDS-PAGE;> 95% by SEC-HPLC
Dry ice Yes
Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
NCBI Macrophage migion inhibitory factor/MIF
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias GIF,GLIF,MMIF,MIF,GLIF,MMIF
Shipping condition Dry ice
Available
Manufacturer - Category
Cytokines
Shipping Temperature
dry ice
Storage Conditions
Store at ≤-70°C, stable for 6 months after receipt. Store at ≤-70°C, stable for 3 months under sterile conditions after opening. Please minimize freeze-thaw cycles.
Description
Recombinant human Macrophage migration inhibitory factor/MIF Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Ala115) of human Macrophage migration inhibitory factor/MIF (Accession #NP_002406.1) fused with a 6xHis tag at the N-terminus.
Background
MIF (or macrophage migration inhibitory factor) was the first lymphokine/cytokine to be recognized in the pregenomics era (1, 2). Regardless, it is one of the least understood of all inflammatory mediators (1, 3). Human MIF is a 12.5 kDa, 115 amino acid (aa) nonglycosylated polypeptide that is synthesized without a signal sequence (4 - 7). Secretion occurs nonclassically via an ABCA1 transporter (8). The initiating Met is removed, leaving Pro as the first amino acid. The molecule consists of two alpha -helices and six beta -strands, four of which form a beta -sheet. The two remaining beta -strands interact with other MIF molecules, creating a trimer (2, 9, 10). Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position #1 (11). Amino acids 50 - 65 have also been suggested to contain thiol-protein oxidoreductase activity (12).
Immunogen
Met1-Ala115
Route
N-His
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Other Recombinant Protein
Protein Formulation
Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 50% Glycerol, pH7.4.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close